Structure of PDB 8g9t Chain A |
>8g9tA (length=70) Species: 754047 (Rhodobacter phage RcNL1) [Search protein sequence] |
MTSFYKITAYNSQALYFWGTDADVDRYVDWLNRDREINVYAAEAIPEAEW AQYEGRDDVLSGEECGWDDF |
|
PDB | 8g9t Exploiting activation and inactivation mechanisms in type I-C CRISPR-Cas3 for genome-editing applications. |
Chain | A |
Resolution | 3.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
A |
Y125 N126 I152 N153 |
Y10 N11 I37 N38 |
|
|
|