Structure of PDB 8g9c Chain A

Receptor sequence
>8g9cA (length=134) Species: 9606 (Homo sapiens) [Search protein sequence]
TRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEE
PSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWE
DSVNIGRKREWFKIEDAIKVLQYHKPVQASYFET
3D structure
PDB8g9c Fluorination Influences the Bioisostery of Myo-Inositol Pyrophosphate Analogs.
ChainA
Resolution1.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.1.10: endopolyphosphatase.
3.6.1.52: diphosphoinositol-polyphosphate diphosphatase.
3.6.1.59: 5'-(N(7)-methyl 5'-triphosphoguanosine)-[mRNA] diphosphatase.
3.6.1.61: diadenosine hexaphosphate hydrolase (ATP-forming).
3.6.1.62: 5'-(N(7)-methylguanosine 5'-triphospho)-[mRNA] hydrolase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 YUT A R10 K18 R20 S39 S40 R41 R89 R115 K133 R2 K10 R12 S31 S32 R33 R81 R107 K125
BS02 MG A G50 E70 G42 E62
BS03 MG A E66 E70 E58 E62
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0000298 endopolyphosphatase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0008486 diphosphoinositol-polyphosphate diphosphatase activity
GO:0016462 pyrophosphatase activity
GO:0016787 hydrolase activity
GO:0030145 manganese ion binding
GO:0034431 bis(5'-adenosyl)-hexaphosphatase activity
GO:0034432 bis(5'-adenosyl)-pentaphosphatase activity
GO:0046872 metal ion binding
GO:0052840 inositol diphosphate tetrakisphosphate diphosphatase activity
GO:0052842 inositol diphosphate pentakisphosphate diphosphatase activity
GO:0052845 inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity
GO:0052848 inositol-3,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity
GO:0140932 5'-(N(7)-methyl 5'-triphosphoguanosine)-[mRNA] diphosphatase activity
GO:0140933 5'-(N(7)-methylguanosine 5'-triphospho)-[mRNA] hydrolase activity
Biological Process
GO:0007267 cell-cell signaling
GO:0015961 diadenosine polyphosphate catabolic process
GO:0071543 diphosphoinositol polyphosphate metabolic process
GO:0071544 diphosphoinositol polyphosphate catabolic process
GO:0110154 RNA decapping
GO:1901907 diadenosine pentaphosphate catabolic process
GO:1901909 diadenosine hexaphosphate catabolic process
GO:1901911 adenosine 5'-(hexahydrogen pentaphosphate) catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0045202 synapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8g9c, PDBe:8g9c, PDBj:8g9c
PDBsum8g9c
PubMed37773020
UniProtO95989|NUDT3_HUMAN Diphosphoinositol polyphosphate phosphohydrolase 1 (Gene Name=NUDT3)

[Back to BioLiP]