Structure of PDB 8fxt Chain A

Receptor sequence

>8fxtA (length=305) Species: 562 (Escherichia coli)

ATRIGVTIYKYDDNFMSVVRKAIEQDAKAAPDVQLLMNDSQNDQSKQNDQ
IDVLLAKGVKALAINLVDPAAAGTVIEKARGQNVPVVFFNKEPSRKALDS
YDKAYYVGTDSKESGIIQGDLIAKHWAANQGWDLNKDGQIQFVLLKGEPG
HPDAEARTTYVIKELNDKGIKTEQLQLDTAMCDTAQAKDKMDAWLSGPNA
NKIEVVIANNDAMAMGAVEALKAHNKSSIPVFGVDALPEALALVKSGALA
GTVLNDANNQAKATFDLAKNLADGKGAADGTNWKIDNKVVRVPYVGVDKD
NLAEF

3D structure

• PDB: 8fxt Chromophore carbonyl twisting in fluorescent biosensors encodes direct readout of protein conformations with multicolor switching.
• Chain: A
• Resolution: 1.53 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	YDM	A	Y10 N43 E149 M182 C183	Y9 N42 E148 M181 C182
BS02	GLC	A	D14 N91 H152 D154 R158 N211 D236 N256	D13 N90 H151 D153 R157 N210 D235 N255
BS03	BGC	A	D13 D40 Q42	D12 D39 Q41
BS04	BGC	A	D14 N91 H152 D154 R158 N211 D236 N256	D13 N90 H151 D153 R157 N210 D235 N255
BS05	BGC	A	D13 N15 D184 T185	D12 N14 D183 T184
BS06	BGC	A	K189 D190	K188 D189
BS07	BGC	A	D121 K125 G297 D299 N302	D120 K124 G296 D298 N301
BS08	CA	A	D134 N136 D138 Q140 Q142 E205	D133 N135 D137 Q139 Q141 E204

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding
• GO:0030246 carbohydrate binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006935 chemotaxis
• GO:0015757 galactose transmembrane transport
• GO:0015765 methylgalactoside transport

Cellular Component

• GO:0016020 membrane
• GO:0030288 outer membrane-bounded periplasmic space
• GO:0042597 periplasmic space
• GO:0055052 ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing

External links

• PDB: RCSB:8fxt, PDBe:8fxt, PDBj:8fxt
• PDBsum: 8fxt
• PubMed: 37598249
• UniProt: P0AEE5|MGLB_ECOLI D-galactose/methyl-galactoside binding periplasmic protein MglB (Gene Name=mglB)