Structure of PDB 8fn0 Chain A

Receptor sequence
>8fn0A (length=282) Species: 10116 (Rattus norvegicus) [Search protein sequence]
NSDLDVNTDIYSKVLVTAIYLALFVVGTVGNSVTLFTLASTVHYHLGSLA
LSDLLILLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNV
ASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGL
QNRSADGTHPGGLVCTPIVDTATVKVVIQVNTFMSFLFPMLVISILNTVI
ANKLTVMQALRHGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTTFL
FDFYHYFYMLTNALFYASSAINPILYNLVSAN
3D structure
PDB8fn0 Neurotensin Receptor Allosterism Revealed in Complex with a Biased Allosteric Modulator.
ChainA
Resolution2.89 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A D54 F128 H132 Y146 V224 T226 F331 W339 Y347 D3 F68 H72 Y86 V164 T166 F238 W246 Y254
BS02 SRW A L163 S164 R167 L310 V313 Y369 L103 S104 R107 L217 V220 Y276
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0005515 protein binding
GO:0016492 G protein-coupled neurotensin receptor activity
GO:0042802 identical protein binding
GO:0044877 protein-containing complex binding
Biological Process
GO:0001659 temperature homeostasis
GO:0003085 negative regulation of systemic arterial blood pressure
GO:0003254 regulation of membrane depolarization
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007218 neuropeptide signaling pathway
GO:0007612 learning
GO:0008344 adult locomotory behavior
GO:0010628 positive regulation of gene expression
GO:0014049 positive regulation of glutamate secretion
GO:0014054 positive regulation of gamma-aminobutyric acid secretion
GO:0033993 response to lipid
GO:0043065 positive regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process
GO:0043576 regulation of respiratory gaseous exchange
GO:0050965 detection of temperature stimulus involved in sensory perception of pain
GO:0051280 negative regulation of release of sequestered calcium ion into cytosol
GO:0051281 positive regulation of release of sequestered calcium ion into cytosol
GO:0060732 positive regulation of inositol phosphate biosynthetic process
GO:0070779 D-aspartate import across plasma membrane
GO:0071545 inositol phosphate catabolic process
GO:0090238 positive regulation of arachidonate secretion
GO:0097151 positive regulation of inhibitory postsynaptic potential
GO:0098712 L-glutamate import across plasma membrane
Cellular Component
GO:0005886 plasma membrane
GO:0009898 cytoplasmic side of plasma membrane
GO:0009986 cell surface
GO:0016020 membrane
GO:0030424 axon
GO:0030425 dendrite
GO:0032280 symmetric synapse
GO:0043025 neuronal cell body
GO:0043195 terminal bouton
GO:0043197 dendritic spine
GO:0043198 dendritic shaft
GO:0043204 perikaryon
GO:0043679 axon terminus
GO:0044309 neuron spine
GO:0045121 membrane raft

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fn0, PDBe:8fn0, PDBj:8fn0
PDBsum8fn0
PubMed36917754
UniProtP20789|NTR1_RAT Neurotensin receptor type 1 (Gene Name=Ntsr1)

[Back to BioLiP]