Structure of PDB 8fmo Chain A

Receptor sequence
>8fmoA (length=156) Species: 9606 (Homo sapiens) [Search protein sequence]
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQ
NPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMGKSEEELSDLFRMFD
KNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLE
FMKGVE
3D structure
PDB8fmo Structural and Phenotypic Correction of K210del Genetic Cardiomyopathy by an FDA Approved drug
ChainA
Resolution2.612 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CA A D65 D67 T71 E76 D65 D67 T71 E76
BS02 CA A D105 N107 D109 Y111 E116 D100 N102 D104 Y106 E111
BS03 CA A D141 N143 D145 R147 E152 D136 N138 D140 R142 E147
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0031013 troponin I binding
GO:0031014 troponin T binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0048306 calcium-dependent protein binding
GO:0051015 actin filament binding
Biological Process
GO:0002086 diaphragm contraction
GO:0003009 skeletal muscle contraction
GO:0006937 regulation of muscle contraction
GO:0010038 response to metal ion
GO:0014883 transition between fast and slow fiber
GO:0032972 regulation of muscle filament sliding speed
GO:0043462 regulation of ATP-dependent activity
GO:0055010 ventricular cardiac muscle tissue morphogenesis
GO:0060048 cardiac muscle contraction
Cellular Component
GO:0005829 cytosol
GO:0005861 troponin complex
GO:0043292 contractile muscle fiber
GO:1990584 cardiac Troponin complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8fmo, PDBe:8fmo, PDBj:8fmo
PDBsum8fmo
PubMed
UniProtP63316|TNNC1_HUMAN Troponin C, slow skeletal and cardiac muscles (Gene Name=TNNC1)

[Back to BioLiP]