Structure of PDB 8fjo Chain A

Receptor sequence

>8fjoA (length=423) Species: 1348799 (Mycobacterium marinum ATCC BAA-535)

GLLPRVNGTPPPEVPLADIELGSLEFWGRDDDFRDGAFATLRREAPISFW
PPIELAGLTAGKGHWALTKHDDIHFASRHPEIFHSSPNIVIHDQTPELAE
YFGSMIVLDDPRHQRLRSIVSRAFTPKVVARIEASVRERAHRLVAAMIEN
HPDGQADLVSELAGPLPLQIICDMMGIPEEDHEQIFHWTNVILGFGDPDL
TTDFDEFLQVSMAIGGYATALADDRRVNHHGDLTTSLVEAEVDGERLSSS
EIAMFFILLVVAGNETTRNAISHGMLALSRYPDERAKWWSDFDGLAATAV
EEIVRWASPVVYMRRTLSQDVDLRGTKMAAGDKVTLWYCSANRDEEKFAD
PWTFDVTRNPNPQVGFGGGGAHFCLGANLARREIRVVFDELRRQMPDVVA
TEEPARLLSQFIHGIKRLPVAWS

3D structure

• PDB: 8fjo The catalytic activity and structure of the lipid metabolizing CYP124 cytochrome P450 enzyme from Mycobacterium marinum.
• Chain: A
• Resolution: 1.69 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	M110 I111 H118 R122 L264 A267 G268 T271 T272 R320 G370 F371 H377 C379 L380 G381 A385	M105 I106 H113 R117 L259 A262 G263 T266 T267 R315 G365 F366 H372 C374 L375 G376 A380
BS02	Y7R	A	I94 V266 A267 M318	I89 V261 A262 M313
BS03	SO4	A	G66 K67 H97 K338	G61 K62 H92 K333
BS04	SO4	A	R136 H235 G236	R131 H230 G231

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0008395 steroid hydroxylase activity
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0020037 heme binding
• GO:0036199 cholest-4-en-3-one 26-monooxygenase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006707 cholesterol catabolic process

External links

• PDB: RCSB:8fjo, PDBe:8fjo, PDBj:8fjo
• PDBsum: 8fjo
• PubMed: 36842492
• UniProt: B2HHT9