Structure of PDB 8ffz Chain A

Receptor sequence

>8ffzA (length=314) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

NRPKTYFCDYDGCDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKS
HLERHLYTHSDTKPFQCSYCGKGVTTRQQLKRHEVTHTKSFICPEEGCNL
RFYKHPQLRAHILSVHLHKLTCPHCNKSFQRPYRLRNHISKHHDPEVENP
YQCTFAGCCKEFRIWSQLQSHIKNDHPKLKCPICSKPCVGENGLQMHMII
HDDSLVTKNWKCHICPDMSFSRKHDLLTHYGSIHTEEDIPLELKYKISNN
NVEFLQNEVDLEKRLESGENGLNLLLNTVGRKYRCFYNNCSRTFKTKEKY
EKHIDKHKVHELKL

3D structure

PDB

8ffz Structural basis of TFIIIC-dependent RNA polymerase III transcription initiation.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	K58 K87 K91 H94 R97 H98 T101 K115 Q122 F134 H148 R152 K170 Q173 R177 K184 H185 R374 K381	K15 K44 K48 H51 R54 H55 T58 K72 Q79 F91 H105 R109 K127 Q130 R134 K141 H142 R292 K299
BS02	dna	A	R45 Y49 R62 P63 S64 K92 R120 Q121 K147 P149 R152 A153 R174 Y176 R177	R2 Y6 R19 P20 S21 K49 R77 Q78 K104 P106 R109 A110 R131 Y133 R134
BS03	ZN	A	C51 C56 H69 H74	C8 C13 H26 H31
BS04	ZN	A	C82 C85 H98 H102	C39 C42 H55 H59
BS05	ZN	A	C110 C113 H126	C67 C70 H83
BS06	ZN	A	C136 C141 H154 H159	C93 C98 H111 H116
BS07	ZN	A	C165 C168 H181 H186	C122 C125 H138 H143
BS08	ZN	A	C224 C227 H240 H244	C181 C184 H197 H201
BS09	ZN	A	C255 C258 H272	C212 C215 H229
BS10	ZN	A	C367 C372 H385 H389	C285 C290 H303 H307
BS11	ZN	A	C196 C201 H214 H219	C153 C158 H171 H176

Gene Ontology

	Molecular Function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001002	RNA polymerase III type 1 promoter sequence-specific DNA binding
GO:0001010	RNA polymerase II sequence-specific DNA-binding transcription factor recruiting activity
GO:0003677	DNA binding
GO:0003723	RNA binding
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006357	regulation of transcription by RNA polymerase II
GO:0042791	5S class rRNA transcription by RNA polymerase III

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ffz, PDBe:8ffz, PDBj:8ffz
PDBsum	8ffz
PubMed	37402369
UniProt	P39933\|TF3A_YEAST Transcription factor IIIA (Gene Name=PZF1)

[Back to BioLiP]