Structure of PDB 8ffu Chain A

Receptor sequence

>8ffuA (length=360) Species: 1166 (Dolichospermum flos-aquae)

LLEMWLSEYERVPYNLGESSVDNFTLGELLNLTGDRDALDQLSLMNNDTH
GSLRLREAIASLDKSVSPDDILVTAGTTEAILIYFKVRYRSGANVVVPVP
TFHVLYETPAFLGYEVRYLQLRAENGFRIDPQELAKLVDDNTEVIVLNTP
QNPSGVVCSETEIQSIIEIAEKHNAEILADEHYRFLPHTEILPSLYGLSP
KIISLGSTGKCFGCIGLRIGWLIGNPEIIKACHFFKDYTTHTVCVLNDYI
AAGVLLHKGKILPRYRQMIQHNIQQFETFIKQQRGLIDWVKPEAGTIAFP
FFTDPNINSKIVAKRLVEDHGVLLLPGEAFDRPSHFRIALGVEPSLFQYA
LEKLAIVIET

3D structure

• PDB: 8ffu Mechanistic and Structural Insights into a Divergent PLP-Dependent l-Enduracididine Cyclase from a Toxic Cyanobacterium.
• Chain: A
• Resolution: 2.04 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	A66 D69 V72	A60 D63 V66
BS02	XUR	A	L8 S25 T83 T84 F108 N158 D186 H188 Y189 K219 R227 R346	L2 S19 T77 T78 F102 N152 D180 H182 Y183 K210 R218 R337

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 22 16:14:21 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8ffu', asym_id = 'A', title = 'Mechanistic and Structural Insights into a Diver...duracididine Cyclase from a Toxic Cyanobacterium.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8ffu', asym_id='A', title='Mechanistic and Structural Insights into a Diver...duracididine Cyclase from a Toxic Cyanobacterium.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009058,0030170', uniprot = '', pdbid = '8ffu', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009058,0030170', uniprot='', pdbid='8ffu', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>