Structure of PDB 8evz Chain A

Receptor sequence

>8evzA (length=313) Species: 208964 (Pseudomonas aeruginosa PAO1)

CLDSLLNGTQDPKAFGRVAVLFGGKSAEREVSLKSGAMVLQSLLAAGVDA
FGIDVGEDLLQRLVEEKIDRAFIILHGRGGEDGSMQGLLECAGIPYTGSG
VLASALAMDKLRTKRVWLSLGLPTPDYAVLASEDDCREAAQRLGFPLIVK
PAHEGSSIGMAKVGGLDELIAAWREAARYDSQVLVEQWISGPEFTVATLR
GQVLPAIRLGTPHTFYDYDAKYLASDTRYQVPCGLDEAKERELKELTARA
CDALGIQGWGRADVMQDAEGRFWLLEVNTAPGMTDHSLVPMAARAAGLDF
QQLVLAILADSRE

3D structure

• PDB: 8evz Comparative functional and structural analysis of Pseudomonas aeruginosa d-alanine-d-alanine ligase isoforms as prospective antibiotic targets.
• Chain: A
• Resolution: 2.45 Å

Enzymatic activity

• Enzyme Commision number: 6.3.2.4: D-alanine--D-alanine ligase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	D266 E279	D263 E276
BS02	MG	A	E279 N281	E276 N278
BS03	ADP	A	K113 I151 K153 G158 S160 M163 E189 W191 I192 E196 F218 Y219 M268 L278 E279	K110 I148 K150 G155 S157 M160 E186 W188 I189 E193 F215 Y216 M265 L275 E276
BS04	DS0	A	E31 H79 S159 K224 R264 E279 N281 G285	E28 H76 S156 K221 R261 E276 N278 G282

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0005524 ATP binding
• GO:0008716 D-alanine-D-alanine ligase activity
• GO:0016874 ligase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0008360 regulation of cell shape
• GO:0009252 peptidoglycan biosynthetic process
• GO:0071555 cell wall organization

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:8evz, PDBe:8evz, PDBj:8evz
• PDBsum: 8evz
• PubMed: 37581574
• UniProt: Q9LCT6|DDLB_PSEAE D-alanine--D-alanine ligase B (Gene Name=ddlB)