Structure of PDB 8evf Chain A

Receptor sequence

>8evfA (length=411) Species: 9606 (Homo sapiens)

TGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSY
EARAFGVTRSMWADDAKKLCPDLLLAQVRESRGKANLTKYREASVEVMEI
MSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQ
QKEGMRKQGLFQWLDSLLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAG
ISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSLGGKLGAS
VIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQL
PKTIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQ
LVVSIRVQSSLRRCCALTRYDAHKMSHDAFTVIKNCNTSGIQTEWSPPLT
MLFLCATKFSA

3D structure

• PDB: 8evf The peroxidation-derived DNA adduct, 6-oxo-M 1 dG, is a strong block to replication by human DNA polymerase eta.
• Chain: A
• Resolution: 2.87 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Q38 Y39 W42 W64 K86 K311 R313 P316 K317 T318 I319 G320 C321 S322 K323 N324 P326 G327 R351	Q36 Y37 W40 W62 K84 K296 R298 P301 K302 T303 I304 G305 C306 S307 K308 N309 P311 G312 R336
BS02	dna	A	S113 E116 S257 G259 G260 K261 L262 R382 R383	S111 E114 S242 G244 G245 K246 L247 R362 R363
BS03	DCP	A	D13 M14 C16 F17 F18 Y52 R55 R61 D115	D11 M12 C14 F15 F16 Y50 R53 R59 D113
BS04	CA	A	D13 M14 D115	D11 M12 D113
BS05	CA	A	D13 D115 E116	D11 D113 E114

Gene Ontology

Molecular Function

• GO:0003684 damaged DNA binding

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:8evf, PDBe:8evf, PDBj:8evf
• PDBsum: 8evf
• PubMed: 37468099
• UniProt: Q9Y253|POLH_HUMAN DNA polymerase eta (Gene Name=POLH)