Structure of PDB 8eqs Chain A

Receptor sequence
>8eqsA (length=192) Species: 2901879 (Severe acute respiratory syndrome coronavirus) [Search protein sequence]
SLPFGWLVIGVAFLAVFQSATKIIALNKRWQLALYKGFQFICNLLLLFVT
IYSHLLLVAAGMEAQFLYLYALIYFLQCINACRIIMRCWLCWKCKSKNPL
LYDANYFVCWHTHNYDYCIPYNSVTDTIVVTEGDGKEDYQIGGYSEDRHS
GVKDYVVVHGYFTEVYYQLESTQITTDTGIENATFFIFNKLV
3D structure
PDB8eqs The SARS-CoV-2 accessory protein Orf3a is not an ion channel, but does interact with trafficking proteins.
ChainA
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A W128 F207 W89 F162
Gene Ontology
Molecular Function
GO:0005216 monoatomic ion channel activity
GO:0005515 protein binding
GO:0015267 channel activity
GO:0042802 identical protein binding
Biological Process
GO:0006915 apoptotic process
GO:0019049 virus-mediated perturbation of host defense response
GO:0034220 monoatomic ion transmembrane transport
GO:0039502 symbiont-mediated suppression of host type I interferon-mediated signaling pathway
GO:0052170 symbiont-mediated suppression of host innate immune response
GO:0098662 inorganic cation transmembrane transport
Cellular Component
GO:0005576 extracellular region
GO:0005886 plasma membrane
GO:0005891 voltage-gated calcium channel complex
GO:0008076 voltage-gated potassium channel complex
GO:0016020 membrane
GO:0020002 host cell plasma membrane
GO:0030430 host cell cytoplasm
GO:0044177 host cell Golgi apparatus
GO:0044178 host cell Golgi membrane
GO:0044423 virion component
GO:0055036 virion membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8eqs, PDBe:8eqs, PDBj:8eqs
PDBsum8eqs
PubMed36695574
UniProtP59632|AP3A_SARS ORF3a protein (Gene Name=3a)

[Back to BioLiP]