Structure of PDB 8eqm Chain A

Receptor sequence

>8eqmA (length=333) Species: 91464 (Synechococcus sp. PCC 7335) [Search protein sequence]

SQWERFCQWITSTENRLYIGWFGVLMLPLLGVSITVFVTAFIAAPPVDID
GIREPLSGSLLYGNNIITAAVVPTSNAIGLHFYPIWEAATLDEWLYNGGP
YQMIAFHYIPALLCYLGREWELSYRLGMRPWICIAYSAPVAATISVFLIY
PIGQGSFSDGLPMGISGTFNFMFVFQAEHNILMHPFHMLGVAGVLGGSLF
CAMHGSLVTSSLVRETSDSQSQNEGYKFGQEEETYNILAAHGYFGRLIFQ
YASFNNSRQLHFFLAAWPVVCIWFVALGISTMAFNLNGFNFNHSVLDSQG
RVLPSWADVVNRASLGFEVMHERNAHNFPLDLA

3D structure

PDB

8eqm Structure of a dimeric photosystem II complex from a cyanobacterium acclimated to far-red light.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	OEX	A	D171 E190 H333 E334 H338 D343 L344 A345	D159 E178 H321 E322 H326 D331 L332 A333
BS02	FE2	A	H216 H273	H204 H261
BS03	CLA	A	L124 P151 A154 T155 M184 F187 Q188 I193 L194 H199 G202 V203 V206 I284 V287 I291	L112 P139 A142 T143 M172 F175 Q176 I181 L182 H187 G190 V191 V194 I272 V275 I279
BS04	CLA	A	M200 V203 A204	M188 V191 A192
BS05	PHO	A	L42 Y127 E131 A147 Y148 P151 M175 G176 P280	L30 Y115 E119 A135 Y136 P139 M163 G164 P268
BS06	CLA	A	L41 V44 F94 P96 I97 W98 M115 H119	L29 V32 F82 P84 I85 W86 M103 H107
BS07	BCT	A	H216 Y247 H273	H204 Y235 H261
BS08	CLA	A	F34 L37 L125 C126 G129 W132	F22 L25 L113 C114 G117 W120
BS09	CL7	A	T155 I177 T180 F181 M184	T143 I165 T168 F169 M172
BS10	PHO	A	L207 L211 M215	L195 L199 M203

Gene Ontology

	Molecular Function
GO:0009055	electron transfer activity
GO:0016168	chlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009635	response to herbicide
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009523	photosystem II
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8eqm, PDBe:8eqm, PDBj:8eqm
PDBsum	8eqm
PubMed	36549647
UniProt	B4WKH9

[Back to BioLiP]