Structure of PDB 8enp Chain A |
>8enpA (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] |
GSHMATACKRSGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACT NEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHP |
|
PDB | 8enp Differences in structure, dynamics and Zn-coordination between isoforms of human ubiquitin ligase UBE3A |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
2.3.2.26: HECT-type E3 ubiquitin transferase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C44 C49 C54 C83 |
C44 C49 C54 C83 |
|
|
|