Structure of PDB 8eml Chain A

Receptor sequence
>8emlA (length=58) Species: 10090 (Mus musculus) [Search protein sequence]
RMRTAFTSTQLLELEREFSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNR
RVKHKKEG
3D structure
PDB8eml Crystal Structure of Gsx2 Homeodomain in Complex with DNA
ChainA
Resolution2.21 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A T211 S212 T213 T7 S8 T9
BS02 dna A R207 Y227 Q252 R255 R3 Y23 Q48 R51
BS03 dna A R205 R207 T208 F210 N253 R1 R3 T4 F6 N49
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8eml, PDBe:8eml, PDBj:8eml
PDBsum8eml
PubMed
UniProtP31316|GSX2_MOUSE GS homeobox 2 (Gene Name=Gsx2)

[Back to BioLiP]