Structure of PDB 8egd Chain A

Receptor sequence

>8egdA (length=325) Species: 10116 (Rattus norvegicus) [Search protein sequence]

NQSAIDVVAEKPSVRLTPTMMLYSGRSHLLKSGRYLQQELPVRIAHRIKG
FRSLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQL
LDDHKDVVTLLAEGLRESRKHIEDEKLVRYFLDKTLTSRLGIRMLATHHL
ALHEDKPDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAPRVRINGHV
AARFPFIPMPLDYILPELLKNAMRATMESHLDTPYNVPDVVITIANNDVD
LIIRISDRGGGIAHKDLDRVMDYHFTTAFGFGLPTSRAYAEYLGGSLQLQ
SLQGIGTDVYLRLRHIDGREESFRI

3D structure

PDB

8egd Structural studies identify angiotensin II receptor blocker-like compounds as branched-chain ketoacid dehydrogenase kinase inhibitors.

Chain

Resolution

2.047 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

2.7.11.1: non-specific serine/threonine protein kinase.
2.7.11.4: [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	ADP	A	K248 N249 R252 A253 I290 V298 T304 T305 G337 G339 L340	K220 N221 R224 A225 I262 V270 T276 T277 G280 G282 L283
BS02	MG	A	E245 K248 N249	E217 K220 N221
BS03	WIH	A	M45 R71 G169 M172 L173 H176 I191 Y349 F380	M21 R43 G141 M144 L145 H148 I163 Y292 F323
BS04	WIH	A	Y99 L106 L128 L129 H132 R167 I170 R171	Y71 L78 L100 L101 H104 R139 I142 R143
BS05	WIH	A	L82 P83 I86 L143 L155 V156 F159	L54 P55 I58 L115 L127 V128 F131

Gene Ontology

	Molecular Function
GO:0004672	protein kinase activity
GO:0004674	protein serine/threonine kinase activity
GO:0004722	protein serine/threonine phosphatase activity
GO:0004740	pyruvate dehydrogenase (acetyl-transferring) kinase activity
GO:0005524	ATP binding
GO:0016301	kinase activity
GO:0016772	transferase activity, transferring phosphorus-containing groups
GO:0047323	[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase activity
GO:0106310	protein serine kinase activity

	Biological Process
GO:0006550	isoleucine catabolic process
GO:0006552	L-leucine catabolic process
GO:0006574	valine catabolic process
GO:0007283	spermatogenesis
GO:0008610	lipid biosynthetic process
GO:0009083	branched-chain amino acid catabolic process
GO:0010906	regulation of glucose metabolic process
GO:0016310	phosphorylation

	Cellular Component
GO:0005739	mitochondrion
GO:0005759	mitochondrial matrix
GO:0045252	oxoglutarate dehydrogenase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8egd, PDBe:8egd, PDBj:8egd
PDBsum	8egd
PubMed	36717078
UniProt	Q00972\|BCKD_RAT Branched-chain alpha-ketoacid dehydrogenase kinase (Gene Name=Bckdk)

[Back to BioLiP]