Structure of PDB 8eek Chain A

Receptor sequence

>8eekA (length=434) Species: 1697 (Corynebacterium ammoniagenes)

KVVIIGAGFAGLVAARELQTAGIEYEILEAKDRIGGRAWTEERMGRPLEL
GATWVHWFQAHTWTEIMRYGQRTEITASPSGNDAHWVTDGKVVKGTEDDL
DEKLTAAMGVTYEGSEEYFPNPHDPLWVLSDDFDGPAEVRERFLSDDQTN
AIDLVKEAGFDQETIDLVDAFWCAGYIGDPYTGSALMAKQWGALSDNRYR
VMEDITLKWKLNNGMRSLYDGIAGDLNTDIRLNTPVAKVEHATVTTESGE
VIEASAVICTVPVGALSNIEFSPALPDAVQSVIDDKWNSQGAKIWIKIKG
HHRFLGYAPKPAKMSVVRSEYFMDDDTTILVGFGYDNTNIDLNSIEDAQA
VINQWRDDLEVVDTTGHNWVADKWAGQAWGTLRKGQFTQGWSLFDDIDLF
FAGSDYAYGWRGVCVDGALEKGMTTARQVINSMR

3D structure

• PDB: 8eek Structural Insights into the Substrate Range of a Bacterial Monoamine Oxidase.
• Chain: A
• Resolution: 1.51 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	I9 G10 G12 A14 E33 A34 G40 R41 G55 A56 T57 W58 V240 T268 V269 W382 A386 W387 G413 S414 V423 C424 V425 A428	I5 G6 G8 A10 E29 A30 G36 R37 G51 A52 T53 W54 V236 T260 V261 W374 A378 W379 G403 S404 V413 C414 V415 A418
BS02	AEF	A	T210 L211 W387 V423	T206 L207 W379 V413

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 30 14:43:42 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8eek', asym_id = 'A', title = 'Structural Insights into the Substrate Range of a Bacterial Monoamine Oxidase.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8eek', asym_id='A', title='Structural Insights into the Substrate Range of a Bacterial Monoamine Oxidase.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016491', uniprot = '', pdbid = '8eek', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491', uniprot='', pdbid='8eek', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>