Structure of PDB 8eei Chain A

Receptor sequence

>8eeiA (length=439) Species: 1697 (Corynebacterium ammoniagenes)

KVVIIGAGFAGLVAARELQTAGIEYEILEAKDRIGGRAWTEERMGRPLEL
GATWVHWFQAHTWTEIMRYGQRTEITASPSGNDAHWVTDGKVVKGTEDDL
DEKLTAAMGVTYEGSEEYFPNPHDPLWVLSDDFDGPAEVRERFLSDDQTN
AIDLVKEAGFDQETIDLVDAFWCAGYIGDPYTGSALMAKQWGALSDNRYR
VMEDITLKWKLNNGMRSLYDGIAGDLNTDIRLNTPVAKVEHHDNGATVTT
ESGEVIEASAVICTVPVGALSNIEFSPALPDAVQSVIDDKWNSQGAKIWI
KIKGHHRFLGYAPKPAKMSVVRSEYFMDDDTTILVGFGYDNTNIDLNSIE
DAQAVINQWRDDLEVVDTTGHNWVADKWAGQAWGTLRKGQFTQGWSLFDD
ISQLFFAGSDYAYGWRGVCVDGALEKGMTTARQVINSMR

3D structure

• PDB: 8eei Structural Insights into the Substrate Range of a Bacterial Monoamine Oxidase.
• Chain: A
• Resolution: 1.78 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	I9 G10 G12 A14 E33 A34 G40 R41 G55 A56 T57 W58 P239 V240 T268 V269 W382 A386 W387 G413 S414 G422 V423 C424 V425 A428	I5 G6 G8 A10 E29 A30 G36 R37 G51 A52 T53 W54 P235 V236 T264 V265 W378 A382 W383 G408 S409 G417 V418 C419 V420 A423

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Nov 27 01:34:56 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8eei', asym_id = 'A', title = 'Structural Insights into the Substrate Range of a Bacterial Monoamine Oxidase.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8eei', asym_id='A', title='Structural Insights into the Substrate Range of a Bacterial Monoamine Oxidase.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016491', uniprot = '', pdbid = '8eei', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491', uniprot='', pdbid='8eei', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>