Structure of PDB 8ede Chain A

Receptor sequence
>8edeA (length=219) Species: 9606 (Homo sapiens) [Search protein sequence]
QLKPMEINPEMLNKVLSRLGVAGQWRFVDVLGLEEESLGSVPAPACALLL
LFPLTAQHENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVAN
NQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGC
RVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCR
EFTEREQGEVRFSAVALCK
3D structure
PDB8ede Crystal structure of covalent inhibitor 2-chloro-N'-(N-(4-chlorophenyl)-N-methylglycyl)acetohydrazide bound to Ubiquitin C-terminal Hydrolase-L1
ChainA
Resolution1.799 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.4.19.12: ubiquitinyl hydrolase 1.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 WEU A Q84 N88 C90 R153 F160 R178 Q83 N87 C89 R151 F158 R176
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0004843 cysteine-type deubiquitinase activity
GO:0005515 protein binding
GO:0008234 cysteine-type peptidase activity
GO:0008242 omega peptidase activity
GO:0031625 ubiquitin protein ligase binding
GO:0031694 alpha-2A adrenergic receptor binding
GO:0043022 ribosome binding
GO:0043130 ubiquitin binding
Biological Process
GO:0002176 male germ cell proliferation
GO:0002931 response to ischemia
GO:0006508 proteolysis
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0007409 axonogenesis
GO:0007412 axon target recognition
GO:0007628 adult walking behavior
GO:0016241 regulation of macroautophagy
GO:0016579 protein deubiquitination
GO:0019896 axonal transport of mitochondrion
GO:0042755 eating behavior
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043407 negative regulation of MAP kinase activity
GO:0045821 positive regulation of glycolytic process
GO:0050905 neuromuscular process
GO:0055001 muscle cell development
GO:0071466 cellular response to xenobiotic stimulus
Cellular Component
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030424 axon
GO:0043025 neuronal cell body
GO:0044306 neuron projection terminus
GO:1904115 axon cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ede, PDBe:8ede, PDBj:8ede
PDBsum8ede
PubMed38488146
UniProtP09936|UCHL1_HUMAN Ubiquitin carboxyl-terminal hydrolase isozyme L1 (Gene Name=UCHL1)

[Back to BioLiP]