Structure of PDB 8ea5 Chain A |
>8ea5A (length=119) Species: 9606 (Homo sapiens) [Search protein sequence] |
TESYCGPCPKNWICYKNNCYQFFDEEKNWYESQASCMSQNASLLKVYSKE DQDLLKLVKSYHWMGLVHIWQWEDGSSLSPNLLTIIEMQKGDCALYASSF KGYIENCSTPNTYICMQRT |
|
PDB | 8ea5 Identification of small-molecule protein-protein interaction inhibitors for NKG2D. |
Chain | A |
Resolution | 1.63 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
VN8 |
A |
F113 V149 |
F22 V58 |
|
|
|
|