Structure of PDB 8e9g Chain A |
>8e9gA (length=122) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] |
MALYTPILILGAIAAVFAVVSVGIALVIGPRRFNRSKLEAYECGIDPLPP VAAGLTGQRIPIRYYLIAMLFIVFDIEIVFLYPWAVAFDSLGLFAVIEML LFMLTVFVAYAYVWRRGGLNWD |
|
PDB | 8e9g Structure of mycobacterial respiratory complex I. |
Chain | A |
Resolution | 2.6 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MQ9 |
A |
F17 S21 |
F17 S21 |
|
|
|
|