Structure of PDB 8e8h Chain A

Receptor sequence

>8e8hA (length=425) Species: 9606 (Homo sapiens)

GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGI
IAVSYEARAFGVTRSMWADDAKKLCPDLLLAQVRESRGKANLTKYREASV
EVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYI
EGLPQGQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIE
RETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKI
RSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGI
EHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKD
RNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAFTVIKN
CNTSGTEWSPPLTMLFLCATKFSAS

3D structure

• PDB: 8e8h Primer terminal ribonucleotide alters the active site dynamics of DNA polymerase eta and reduces DNA synthesis fidelity.
• Chain: A
• Resolution: 2.13 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Q38 Y39 W42 W64 K86 R93 K311 K317 T318 I319 G320 S322 K323 N324 P326 R351	Q41 Y42 W45 W67 K89 R96 K306 K312 T313 I314 G315 S317 K318 N319 P321 R346
BS02	dna	A	F17 F18 Q38 I48 R61 D115 E116 S257 G259 K261 L262 R377 R382 R383 C384	F20 F21 Q41 I51 R64 D118 E119 S252 G254 K256 L257 R372 R377 R378 C379
BS03	MN	A	D13 M14 D115	D16 M17 D118
BS04	DGT	A	D13 M14 D15 C16 F17 F18 Q38 I48 A49 Y52 R55 R61 D115 K231	D16 M17 D18 C19 F20 F21 Q41 I51 A52 Y55 R58 R64 D118 K226
BS05	MN	A	D13 D115 E116	D16 D118 E119

Gene Ontology

Molecular Function

• GO:0003684 damaged DNA binding

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:8e8h, PDBe:8e8h, PDBj:8e8h
• PDBsum: 8e8h
• PubMed: 36702254
• UniProt: Q9Y253|POLH_HUMAN DNA polymerase eta (Gene Name=POLH)