Structure of PDB 8e3e Chain A

Receptor sequence

>8e3eA (length=111) Species: 9606 (Homo sapiens) [Search protein sequence]

FQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHMR
KHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDH
LHRHLKKDGCN

3D structure

PDB

8e3e Structural basis for transcription factor ZBTB7A recognition of DNA and effects of ZBTB7A somatic mutations that occur in human acute myeloid leukemia.

Chain

Resolution

2.99 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	K389 I391 Q392 G393 K396 R399 T403 K408 T420 R421 K424 R464 K473 R477 H480 R483	K9 I11 Q12 G13 K16 R19 T23 K28 T40 R41 K44 R84 K93 R97 H100 R103
BS02	dna	A	K396 Q422 Y438 K454 S478 D479 H482	K16 Q42 Y58 K74 S98 D99 H102
BS03	ZN	A	C412 C415 H428 H432	C32 C35 H48 H52
BS04	ZN	A	C387 H400 H404	C7 H20 H24
BS05	ZN	A	C440 C443 H456 H460	C60 C63 H76 H80
BS06	ZN	A	C468 C471 H484 C490	C88 C91 H104 C110

External links

PDB	RCSB:8e3e, PDBe:8e3e, PDBj:8e3e
PDBsum	8e3e
PubMed	36626981
UniProt	O95365\|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A (Gene Name=ZBTB7A)

[Back to BioLiP]