Structure of PDB 8e0a Chain A

Receptor sequence
>8e0aA (length=168) Species: 9606 (Homo sapiens) [Search protein sequence]
FSSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKTSEELTIAGMTFTTF
DLGRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMTDETIANVPIL
ILGNKIDRPEAISEERLREMFGLYGQTTGKGSISLKELNARPLEVFMCSV
LKRQGYGEGFRWMAQYID
3D structure
PDB8e0a The alarmone ppGpp selectively inhibits the isoform A of the human small GTPase Sar1.
ChainA
Resolution1.797 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 GDP A N35 G37 K38 T39 T40 N134 K135 D137 R138 S179 L181 N24 G26 K27 T28 T29 N104 K105 D107 R108 S149 L151
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
GO:0140785 amino acid sensor activity
Biological Process
GO:0002474 antigen processing and presentation of peptide antigen via MHC class I
GO:0003400 regulation of COPII vesicle coating
GO:0006886 intracellular protein transport
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0015031 protein transport
GO:0016050 vesicle organization
GO:0016192 vesicle-mediated transport
GO:0032368 regulation of lipid transport
GO:0042953 lipoprotein transport
GO:0048208 COPII vesicle coating
GO:0055088 lipid homeostasis
GO:0061024 membrane organization
GO:0070863 positive regulation of protein exit from endoplasmic reticulum
GO:0090110 COPII-coated vesicle cargo loading
GO:0140353 lipid export from cell
GO:1903432 regulation of TORC1 signaling
GO:1904262 negative regulation of TORC1 signaling
GO:1990253 cellular response to leucine starvation
Cellular Component
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005765 lysosomal membrane
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0012507 ER to Golgi transport vesicle membrane
GO:0016020 membrane
GO:0030127 COPII vesicle coat
GO:0032580 Golgi cisterna membrane
GO:0070971 endoplasmic reticulum exit site

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8e0a, PDBe:8e0a, PDBj:8e0a
PDBsum8e0a
PubMed36369712
UniProtQ9Y6B6|SAR1B_HUMAN Small COPII coat GTPase SAR1B (Gene Name=SAR1B)

[Back to BioLiP]