Structure of PDB 8dzj Chain A

Receptor sequence

>8dzjA (length=416) Species: 1765684 (Sulfoacidibacillus thermotolerans)

PMIKVYRYEIVKPLDLDWKEFGTILRQLQQETRFALNKATQLAWEWMGFS
SDYKDNHGEYPKSKDILGYTNVHGYAYHTIKTKAYRLNSGNLSQTIKRAT
DRFKAYQKEILRGDMSIPSYKRDIPLDLIKENISVNRMNHGDYIASLSLL
SNPAKQEMNVKRKISVIIIVRGAGKTIMDRILSGEYQVSASQIIHDDRKN
KWYLNISYDFEPNKIMGIALGVAVAVYMAFQHTPARYKLEGGEIENFRRQ
VESRRISMLRQGKYAGGARGGHGRDKRIKPIEQLRDKIANFRDTTNHRYS
RYIVDMAIKEGCGTIQMEDLTNIRDIGSRFLQNWTYYDLQQKIIYKAEEA
GIKVIKIDPQYTSQRCSECGNIDSGNRIGQAIFKCRACGYEANADYNAAR
NIAIPNIDKIIAESIK

3D structure

• PDB: 8dzj An engineered hypercompact CRISPR-Cas12f system with boosted gene-editing activity.
• Chain: A
• Resolution: 2.9 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	I2 Q93 K96 R97 Y105 S188 A189 R291 R298 R330 T341 Y342 Y343	I3 Q94 K97 R98 Y106 S189 A190 R285 R292 R324 T335 Y336 Y337
BS02	dna	A	Y68 T69 H72 Y76 K80 S88 S92 S147 S150 N151 R161	Y69 T70 H73 Y77 K81 S89 S93 S148 S151 N152 R162
BS03	rna	A	K3 V4 Y5 R6 K11 D16 W17 R25 R101 M114 S115 S118 Y119 K120 R121 P124 R136 I168 R170 G171 A172 R197 K198 K200 Y202 R260 S263 Q267 A274 R275 G276 G277 H278 G279 R280 K282 K293 N296 F297 T300 H303 R307 Y351 K352	K4 V5 Y6 R7 K12 D17 W18 R26 R102 M115 S116 S119 Y120 K121 R122 P125 R137 I169 R171 G172 A173 R198 K199 K201 Y203 R254 S257 Q261 A268 R269 G270 G271 H272 G273 R274 K276 K287 N290 F291 T294 H297 R301 Y345 K346
BS04	ZN	A	C375 C391	C369 C385

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003723 RNA binding
• GO:0004519 endonuclease activity
• GO:0046872 metal ion binding

External links

• PDB: RCSB:8dzj, PDBe:8dzj, PDBj:8dzj
• PDBsum: 8dzj
• PubMed: 37400536
• UniProt: A0A2U3D0N8|CS12F_SULT2 CRISPR-associated endodeoxyribonuclease Cas12f1 (Gene Name=cas12f1)