Structure of PDB 8drp Chain A

Receptor sequence
>8drpA (length=512) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
FRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVN
EGGEAEKMELFVSFCEDTIFEMQIAAQISETAREAATALAALLWAVVARW
GELEVQRVKFLNYLSRNFYTLRFLALFLAFAINFILLFYKVSDSPPNMVY
YFLEESTGYMEPALWCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKELAR
KLEFDGLYITEQPGDDDVKGQWDRLVLNTPSFPSNYWDKFVTWLMSIDVK
YQIWKFGVIFTDNSFLYLGWYMVMSLLGHYNNFFFAAHLLDIAMGVKTLR
TILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDM
KCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFV
IVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHG
FETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPA
GDCFRKQYEDQL
3D structure
PDB8drp Cryo-EM analysis of scorpion toxin binding to Ryanodine Receptors reveals subconductance that is abolished by PKA phosphorylation.
ChainA
Resolution2.84 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CFF A E4239 I4242 W4716 I4996 W5011 E66 I69 W237 I472 W487
BS02 ATP A R4215 M4954 E4955 C4958 T4979 H4983 N4984 L4985 R42 M430 E431 C434 T455 H459 N460 L461
BS03 ZN A H4978 H4983 H454 H459
Gene Ontology
Molecular Function
GO:0005216 monoatomic ion channel activity
GO:0005219 ryanodine-sensitive calcium-release channel activity
GO:0005245 voltage-gated calcium channel activity
GO:0005262 calcium channel activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0005516 calmodulin binding
GO:0005524 ATP binding
GO:0015278 intracellularly gated calcium channel activity
GO:0015643 toxic substance binding
GO:0035381 ATP-gated ion channel activity
GO:0042802 identical protein binding
GO:0044325 transmembrane transporter binding
GO:0046872 metal ion binding
GO:0097718 disordered domain specific binding
Biological Process
GO:0003151 outflow tract morphogenesis
GO:0006811 monoatomic ion transport
GO:0006816 calcium ion transport
GO:0006874 intracellular calcium ion homeostasis
GO:0006936 muscle contraction
GO:0006941 striated muscle contraction
GO:0014808 release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
GO:0019722 calcium-mediated signaling
GO:0043588 skin development
GO:0043931 ossification involved in bone maturation
GO:0048741 skeletal muscle fiber development
GO:0051209 release of sequestered calcium ion into cytosol
GO:0051289 protein homotetramerization
GO:0055085 transmembrane transport
GO:0070588 calcium ion transmembrane transport
GO:0071277 cellular response to calcium ion
GO:0071313 cellular response to caffeine
Cellular Component
GO:0005790 smooth endoplasmic reticulum
GO:0014802 terminal cisterna
GO:0016020 membrane
GO:0016529 sarcoplasmic reticulum
GO:0030018 Z disc
GO:0031090 organelle membrane
GO:0033017 sarcoplasmic reticulum membrane
GO:0034704 calcium channel complex
GO:0042383 sarcolemma
GO:1990425 ryanodine receptor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8drp, PDBe:8drp, PDBj:8drp
PDBsum8drp
PubMed37224245
UniProtP11716|RYR1_RABIT Ryanodine receptor 1 (Gene Name=RYR1)

[Back to BioLiP]