Structure of PDB 8dnf Chain A

Receptor sequence
>8dnfA (length=374) Species: 9606 (Homo sapiens) [Search protein sequence]
EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD
SYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH
PVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGI
VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFT
TTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIG
NERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSG
GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLST
FQQMWISKQEYDESGPSIVHRKCF
3D structure
PDB8dnf Structural insights into actin isoforms.
ChainA
Resolution3.38 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.4.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADP A G12 K17 D156 K212 E213 G301 Y305 K335 G12 K17 D156 K212 E213 G301 Y305 K335
Gene Ontology
Molecular Function
GO:0005200 structural constituent of cytoskeleton
GO:0005515 protein binding
GO:0005522 profilin binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0019901 protein kinase binding
GO:0031625 ubiquitin protein ligase binding
GO:0042802 identical protein binding
GO:0098973 structural constituent of postsynaptic actin cytoskeleton
Biological Process
GO:0001525 angiogenesis
GO:0001738 morphogenesis of a polarized epithelium
GO:0007409 axonogenesis
GO:0010628 positive regulation of gene expression
GO:0030335 positive regulation of cell migration
GO:0035633 maintenance of blood-brain barrier
GO:0045214 sarcomere organization
GO:0048870 cell motility
GO:0051492 regulation of stress fiber assembly
GO:0051893 regulation of focal adhesion assembly
GO:0070527 platelet aggregation
GO:0071346 cellular response to type II interferon
GO:0090303 positive regulation of wound healing
GO:0098974 postsynaptic actin cytoskeleton organization
GO:0120192 tight junction assembly
GO:0150111 regulation of transepithelial transport
GO:1900242 regulation of synaptic vesicle endocytosis
GO:1902396 protein localization to bicellular tight junction
Cellular Component
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005884 actin filament
GO:0005886 plasma membrane
GO:0005911 cell-cell junction
GO:0005925 focal adhesion
GO:0015629 actin cytoskeleton
GO:0016020 membrane
GO:0030016 myofibril
GO:0030424 axon
GO:0031941 filamentous actin
GO:0035267 NuA4 histone acetyltransferase complex
GO:0043296 apical junction complex
GO:0044305 calyx of Held
GO:0045177 apical part of cell
GO:0045202 synapse
GO:0045335 phagocytic vesicle
GO:0070062 extracellular exosome
GO:0072562 blood microparticle
GO:0097433 dense body
GO:0098685 Schaffer collateral - CA1 synapse
GO:0120220 basal body patch

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8dnf, PDBe:8dnf, PDBj:8dnf
PDBsum8dnf
PubMed36790143
UniProtP63261|ACTG_HUMAN Actin, cytoplasmic 2 (Gene Name=ACTG1)

[Back to BioLiP]