Structure of PDB 8dks Chain A

Receptor sequence
>8dksA (length=283) Species: 9606 (Homo sapiens) [Search protein sequence]
FHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKK
LATTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGS
LLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILL
DEAFTAKISDFGLARASVMSRIVGTTAYMAPEALRGEITPKSDIYSFGVV
LLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSV
EAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTA
3D structure
PDB8dks Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
ChainA
Resolution2.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 SO9 A M192 A211 Y262 Y264 M265 P266 G268 R273 A315 L318 D329 M28 A47 Y93 Y95 M96 P97 G99 R104 A146 L149 D160
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0005149 interleukin-1 receptor binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0019901 protein kinase binding
GO:0044024 histone H2AS1 kinase activity
GO:0106310 protein serine kinase activity
Biological Process
GO:0002224 toll-like receptor signaling pathway
GO:0002446 neutrophil mediated immunity
GO:0002755 MyD88-dependent toll-like receptor signaling pathway
GO:0006338 chromatin remodeling
GO:0006468 protein phosphorylation
GO:0007165 signal transduction
GO:0007254 JNK cascade
GO:0008063 Toll signaling pathway
GO:0016310 phosphorylation
GO:0019221 cytokine-mediated signaling pathway
GO:0031349 positive regulation of defense response
GO:0034142 toll-like receptor 4 signaling pathway
GO:0034162 toll-like receptor 9 signaling pathway
GO:0035556 intracellular signal transduction
GO:0038172 interleukin-33-mediated signaling pathway
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0045087 innate immune response
GO:0048661 positive regulation of smooth muscle cell proliferation
GO:0070498 interleukin-1-mediated signaling pathway
GO:0071222 cellular response to lipopolysaccharide
GO:1990266 neutrophil migration
Cellular Component
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009986 cell surface
GO:0010008 endosome membrane
GO:0019897 extrinsic component of plasma membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8dks, PDBe:8dks, PDBj:8dks
PDBsum8dks
PubMed35863718
UniProtQ9NWZ3|IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4 (Gene Name=IRAK4)

[Back to BioLiP]