Structure of PDB 8djh Chain A

Receptor sequence
>8djhA (length=85) Species: 9606 (Homo sapiens) [Search protein sequence]
TEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPM
NSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQ
3D structure
PDB8djh Zinc controls PML nuclear body formation through regulation of a paralog specific auto-inhibition in SUMO1.
ChainA
Resolution1.77 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A D15 K16 E20 Y21 E33 I34 H35 F36 K37 V38 K39 K46 R54 E84 D6 K7 E11 Y12 E24 I25 H26 F27 K28 V29 K30 K37 R45 E75
BS02 ZN A E11 D15 E2 D6
BS03 ZN A E84 E85 E75 E76
BS04 ZN A E33 H35 E24 H26
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008134 transcription factor binding
GO:0015459 potassium channel regulator activity
GO:0019899 enzyme binding
GO:0031386 protein tag activity
GO:0031625 ubiquitin protein ligase binding
GO:0044388 small protein activating enzyme binding
GO:0044389 ubiquitin-like protein ligase binding
GO:1990381 ubiquitin-specific protease binding
Biological Process
GO:0006281 DNA repair
GO:0006355 regulation of DNA-templated transcription
GO:0010621 negative regulation of transcription by transcription factor localization
GO:0016925 protein sumoylation
GO:0030578 PML body organization
GO:0031334 positive regulation of protein-containing complex assembly
GO:0031647 regulation of protein stability
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032880 regulation of protein localization
GO:0034605 cellular response to heat
GO:0042308 negative regulation of protein import into nucleus
GO:0043392 negative regulation of DNA binding
GO:0043433 negative regulation of DNA-binding transcription factor activity
GO:0045759 negative regulation of action potential
GO:0045892 negative regulation of DNA-templated transcription
GO:0050821 protein stabilization
GO:0060021 roof of mouth development
GO:0071276 cellular response to cadmium ion
GO:0086004 regulation of cardiac muscle cell contraction
GO:0090204 protein localization to nuclear pore
GO:1901896 positive regulation of ATPase-coupled calcium transmembrane transporter activity
GO:1902260 negative regulation of delayed rectifier potassium channel activity
GO:1903169 regulation of calcium ion transmembrane transport
Cellular Component
GO:0001741 XY body
GO:0005634 nucleus
GO:0005643 nuclear pore
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0008076 voltage-gated potassium channel complex
GO:0016604 nuclear body
GO:0016605 PML body
GO:0016607 nuclear speck
GO:0031965 nuclear membrane
GO:0097165 nuclear stress granule
GO:0098978 glutamatergic synapse
GO:0099523 presynaptic cytosol
GO:0099524 postsynaptic cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8djh, PDBe:8djh, PDBj:8djh
PDBsum8djh
PubMed35871297
UniProtP63165|SUMO1_HUMAN Small ubiquitin-related modifier 1 (Gene Name=SUMO1)

[Back to BioLiP]