Structure of PDB 8dgt Chain A

Receptor sequence
>8dgtA (length=431) Species: 9606 (Homo sapiens) [Search protein sequence]
SPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRI
QEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCR
KLLFQGFRCQTCGYKFHQRCSTEVPLMCVNRDRSSSAPNVHDWEIPDGQI
TVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRK
TRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIA
RQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGS
HQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYS
NINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLF
PQILASIELLARSLPKIHRSASEPSLNRAGF
3D structure
PDB8dgt Cryo-EM structure of a RAS/RAF recruitment complex.
ChainA
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 AGS A I463 G466 S467 F468 V471 W531 C532 K578 N581 F583 D594 I156 G159 S160 F161 V164 W224 C225 K271 N274 F276 D287
BS02 ZN A C248 C251 H269 C272 C96 C99 H117 C120
BS03 ZN A H235 C261 C264 C280 H83 C109 C112 C128
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004708 MAP kinase kinase activity
GO:0004709 MAP kinase kinase kinase activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0031267 small GTPase binding
GO:0031434 mitogen-activated protein kinase kinase binding
GO:0042802 identical protein binding
GO:0044024 histone H2AS1 kinase activity
GO:0044877 protein-containing complex binding
GO:0046872 metal ion binding
GO:0097110 scaffold protein binding
GO:0106310 protein serine kinase activity
Biological Process
GO:0000165 MAPK cascade
GO:0001934 positive regulation of protein phosphorylation
GO:0002318 myeloid progenitor cell differentiation
GO:0006338 chromatin remodeling
GO:0006468 protein phosphorylation
GO:0007165 signal transduction
GO:0007173 epidermal growth factor receptor signaling pathway
GO:0008542 visual learning
GO:0009887 animal organ morphogenesis
GO:0010628 positive regulation of gene expression
GO:0010764 negative regulation of fibroblast migration
GO:0010828 positive regulation of D-glucose transmembrane transport
GO:0016079 synaptic vesicle exocytosis
GO:0016310 phosphorylation
GO:0030154 cell differentiation
GO:0030878 thyroid gland development
GO:0033077 T cell differentiation in thymus
GO:0033138 positive regulation of peptidyl-serine phosphorylation
GO:0034446 substrate adhesion-dependent cell spreading
GO:0035019 somatic stem cell population maintenance
GO:0036211 protein modification process
GO:0042127 regulation of cell population proliferation
GO:0043066 negative regulation of apoptotic process
GO:0043149 stress fiber assembly
GO:0043367 CD4-positive, alpha-beta T cell differentiation
GO:0043368 positive T cell selection
GO:0043369 CD4-positive or CD8-positive, alpha-beta T cell lineage commitment
GO:0043434 response to peptide hormone
GO:0043524 negative regulation of neuron apoptotic process
GO:0045580 regulation of T cell differentiation
GO:0046632 alpha-beta T cell differentiation
GO:0048538 thymus development
GO:0048679 regulation of axon regeneration
GO:0048680 positive regulation of axon regeneration
GO:0050772 positive regulation of axonogenesis
GO:0050852 T cell receptor signaling pathway
GO:0051496 positive regulation of stress fiber assembly
GO:0051591 response to cAMP
GO:0060291 long-term synaptic potentiation
GO:0060323 head morphogenesis
GO:0060324 face development
GO:0070371 ERK1 and ERK2 cascade
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0071277 cellular response to calcium ion
GO:0071466 cellular response to xenobiotic stimulus
GO:0072577 endothelial cell apoptotic process
GO:0090150 establishment of protein localization to membrane
GO:0099170 postsynaptic modulation of chemical synaptic transmission
GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
GO:1902531 regulation of intracellular signal transduction
GO:1990090 cellular response to nerve growth factor stimulus
GO:2000301 negative regulation of synaptic vesicle exocytosis
GO:2000352 negative regulation of endothelial cell apoptotic process
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0043005 neuron projection
GO:0043231 intracellular membrane-bounded organelle
GO:0044297 cell body
GO:0098793 presynapse
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8dgt, PDBe:8dgt, PDBj:8dgt
PDBsum8dgt
PubMed37516774
UniProtP15056|BRAF_HUMAN Serine/threonine-protein kinase B-raf (Gene Name=BRAF)

[Back to BioLiP]