Structure of PDB 8cyf Chain A

Receptor sequence
>8cyfA (length=75) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
NWQLQGLCRGMDSSMFFHPDGERGRARTQREQRAKEMCRRCPVIEACRSH
ALEVGEPYGVWGGLSESERDLLLKG
3D structure
PDB8cyf Structural basis of DNA binding by the WhiB-like transcription factor WhiB3 in Mycobacterium tuberculosis.
ChainA
Resolution2.44 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A D35 G36 R38 D20 G21 R23
BS02 SF4 A C23 F31 C53 C56 C62 G77 C8 F16 C38 C41 C47 G62
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0015035 protein-disulfide reductase activity
GO:0035731 dinitrosyl-iron complex binding
GO:0046872 metal ion binding
GO:0047134 protein-disulfide reductase (NAD(P)H) activity
GO:0051536 iron-sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0019216 regulation of lipid metabolic process
GO:0045454 cell redox homeostasis
GO:0045892 negative regulation of DNA-templated transcription
GO:0071766 Actinobacterium-type cell wall biogenesis
GO:0075137 response to host redox environment
Cellular Component
GO:0005737 cytoplasm
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cyf, PDBe:8cyf, PDBj:8cyf
PDBsum8cyf
PubMed37142222
UniProtP9WF41|WHIB3_MYCTU Redox- and pH-responsive transcriptional regulator WhiB3 (Gene Name=whiB3)

[Back to BioLiP]