Structure of PDB 8cvn Chain A

Receptor sequence
>8cvnA (length=256) Species: 9606 (Homo sapiens) [Search protein sequence]
HMVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALD
EQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNW
EKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPV
YCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENM
GQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKG
IHFQDY
3D structure
PDB8cvn Small molecule inhibitors of 15-PGDH exploit a physiologic induced-fit closing system.
ChainA
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.1.1.-
1.1.1.141: 15-hydroxyprostaglandin dehydrogenase (NAD(+)).
1.1.1.232: 15-hydroxyicosatetraenoate dehydrogenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAI A Q15 I17 D36 W37 V65 N91 G93 V94 S138 K155 P183 V186 T188 Q15 I17 D36 W37 V65 N91 G93 V94 S138 K155 P183 V186 T188
BS02 SWL A N95 S138 Q148 Y151 F185 M213 Y217 N95 S138 Q148 Y151 F185 M213 Y217
Gene Ontology
Molecular Function
GO:0004957 prostaglandin E receptor activity
GO:0016404 15-hydroxyprostaglandin dehydrogenase (NAD+) activity
GO:0016491 oxidoreductase activity
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0042802 identical protein binding
GO:0051287 NAD binding
GO:0070403 NAD+ binding
Biological Process
GO:0001822 kidney development
GO:0006693 prostaglandin metabolic process
GO:0007179 transforming growth factor beta receptor signaling pathway
GO:0007565 female pregnancy
GO:0007567 parturition
GO:0019372 lipoxygenase pathway
GO:0030728 ovulation
GO:0032355 response to estradiol
GO:0032496 response to lipopolysaccharide
GO:0043065 positive regulation of apoptotic process
GO:0045471 response to ethanol
GO:0045786 negative regulation of cell cycle
GO:0070493 thrombin-activated receptor signaling pathway
GO:0097070 ductus arteriosus closure
GO:1904707 positive regulation of vascular associated smooth muscle cell proliferation
GO:1905828 regulation of prostaglandin catabolic process
Cellular Component
GO:0005615 extracellular space
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016323 basolateral plasma membrane
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cvn, PDBe:8cvn, PDBj:8cvn
PDBsum8cvn
PubMed36774348
UniProtP15428|PGDH_HUMAN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] (Gene Name=HPGD)

[Back to BioLiP]