Structure of PDB 8ct2 Chain A

Receptor sequence
>8ct2A (length=247) Species: 9606 (Homo sapiens) [Search protein sequence]
SEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTAVQDNVKV
SLAFGLSIATLAQSVGHISGAHLNPAVTLGLLLSCQISIFRALMYIIAQC
VGAIVATAILSGITSSLTGNSLGRNDLADGVNSGQGLGIEIIGTLQLVLC
VLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVI
THNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQ
3D structure
PDB8ct2 Architecture of the human erythrocyte ankyrin-1 complex.
ChainA
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLR A G136 G140 G134 G138
Gene Ontology
Molecular Function
GO:0005223 intracellularly cGMP-activated cation channel activity
GO:0005267 potassium channel activity
GO:0005372 water transmembrane transporter activity
GO:0005515 protein binding
GO:0008519 ammonium channel activity
GO:0015079 potassium ion transmembrane transporter activity
GO:0015168 glycerol transmembrane transporter activity
GO:0015250 water channel activity
GO:0015267 channel activity
GO:0022857 transmembrane transporter activity
GO:0030184 nitric oxide transmembrane transporter activity
GO:0035379 carbon dioxide transmembrane transporter activity
GO:0042802 identical protein binding
GO:0046875 ephrin receptor binding
GO:0140070 hydrogen peroxide channel activity
Biological Process
GO:0003091 renal water homeostasis
GO:0003094 glomerular filtration
GO:0003097 renal water transport
GO:0006813 potassium ion transport
GO:0006833 water transport
GO:0006884 cell volume homeostasis
GO:0006972 hyperosmotic response
GO:0009992 intracellular water homeostasis
GO:0010761 fibroblast migration
GO:0010763 positive regulation of fibroblast migration
GO:0015670 carbon dioxide transport
GO:0015793 glycerol transmembrane transport
GO:0016477 cell migration
GO:0019233 sensory perception of pain
GO:0019725 cellular homeostasis
GO:0019934 cGMP-mediated signaling
GO:0021670 lateral ventricle development
GO:0030157 pancreatic juice secretion
GO:0030185 nitric oxide transport
GO:0030950 establishment or maintenance of actin cytoskeleton polarity
GO:0032940 secretion by cell
GO:0033326 cerebrospinal fluid secretion
GO:0033363 secretory granule organization
GO:0034644 cellular response to UV
GO:0035377 transepithelial water transport
GO:0035378 carbon dioxide transmembrane transport
GO:0042060 wound healing
GO:0042476 odontogenesis
GO:0043066 negative regulation of apoptotic process
GO:0043154 negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0044241 lipid digestion
GO:0045766 positive regulation of angiogenesis
GO:0046878 positive regulation of saliva secretion
GO:0048146 positive regulation of fibroblast proliferation
GO:0048593 camera-type eye morphogenesis
GO:0050829 defense response to Gram-negative bacterium
GO:0050891 multicellular organismal-level water homeostasis
GO:0051458 corticotropin secretion
GO:0051649 establishment of localization in cell
GO:0055085 transmembrane transport
GO:0070295 renal water absorption
GO:0070301 cellular response to hydrogen peroxide
GO:0071260 cellular response to mechanical stimulus
GO:0071280 cellular response to copper ion
GO:0071288 cellular response to mercury ion
GO:0071300 cellular response to retinoic acid
GO:0071320 cellular response to cAMP
GO:0071456 cellular response to hypoxia
GO:0071472 cellular response to salt stress
GO:0071474 cellular hyperosmotic response
GO:0071549 cellular response to dexamethasone stimulus
GO:0071732 cellular response to nitric oxide
GO:0071805 potassium ion transmembrane transport
GO:0072220 metanephric descending thin limb development
GO:0072230 metanephric proximal straight tubule development
GO:0072232 metanephric proximal convoluted tubule segment 2 development
GO:0072239 metanephric glomerulus vasculature development
GO:0072488 ammonium transmembrane transport
GO:0080170 hydrogen peroxide transmembrane transport
GO:0098655 monoatomic cation transmembrane transport
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0005903 brush border
GO:0009925 basal plasma membrane
GO:0016020 membrane
GO:0016323 basolateral plasma membrane
GO:0016324 apical plasma membrane
GO:0030424 axon
GO:0031526 brush border membrane
GO:0031965 nuclear membrane
GO:0042383 sarcolemma
GO:0045177 apical part of cell
GO:0070062 extracellular exosome
GO:0170014 ankyrin-1 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ct2, PDBe:8ct2, PDBj:8ct2
PDBsum8ct2
PubMed35835865
UniProtP29972|AQP1_HUMAN Aquaporin-1 (Gene Name=AQP1)

[Back to BioLiP]