Structure of PDB 8coh Chain A |
>8cohA (length=132) Species: 9844 (Lama glama) [Search protein sequence] |
EVQLVESGGGLVQPGGSLRLSCAASGRAHSDYAMAWFRQAPGQEREFVAG IGWSGGDTLYADSVRGRFTNSRDNSKNTLYLQMNSLRAEDTAVYYCAARQ GQYIYSSMRSDSYDYWGQGTLVTVSSHHHHHH |
|
PDB | 8coh Characterization of the bispecific VHH antibody gefurulimab (ALXN1720) targeting complement component 5, and designed for low volume subcutaneous administration. |
Chain | A |
Resolution | 1.3 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
A |
H127 H129 |
H127 H129 |
|
|
|