Structure of PDB 8cns Chain A

Receptor sequence

>8cnsA (length=548) Species: 523845 (Methanothermococcus thermolithotrophicus DSM 2095)

MRPSKMFCYQCQETAKNTGCTIIGVCGKKDNVANLQDLLVYTVKGLAVVR
ENLGYSNDKTDRYIVDALFTTITNVNFDDKDIIEKIKEGLALREEAASKS
TCPGCGGDLPDCATWTADSDDEIIKKANSLEVSVLATENEDVRSLRELLT
YGVKGIAAYLHHAMVLGYDNKDIHKFIRKALVATTDDSLSADELTALVLE
CGKYAVDTMALLDKANTETYGHPEITEVDIGVRNNPGILISGHDLKDLEQ
LLEQTKGTGVDVYTHSEMLPAHYYPAFKKYDHFVGNYGGSWWRQKEEFEA
FNGPIVMTTNCLVPPAESYKDRIYTTGVVGFPGLKRIPEDENGNKDFSEV
IEQAKKCAPPKQLETGKIVGGFAHNQVLALADKVVEAVKSGAIRKFVVMA
GCDGRHPSREYYTEFAKKLPNDTVILTAGCAKYRYNKLGLGDIGGIPRVL
DAGQCNDCYSLAVIALKLKEVFELDDINDLPIAFNVAWYEQKAVAVLLAL
LYLGVKDIVLGPTLPAFLSPNVAKVLVEKFGISGITTVDEDIERLINK

3D structure

• PDB: 8cns Structural and biochemical elucidation of class I hybrid cluster protein natively extracted from a marine methanogenic archaeon.
• Chain: A
• Resolution: 1.36 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	D79 K80	D79 K80
BS02	SF4	A	C8 Y9 Q10 C11 T14 C20 G24 V25 C26 K28 T73	C8 Y9 Q10 C11 T14 C20 G24 V25 C26 K28 T73
BS03	SF3	A	H243 E267 W291 C311 C402 C430 C455 E490	H243 E267 W291 C311 C402 C430 C455 E490
BS04	VQ8	A	H243 E267 W291 N310 C311 C402 C430 C455 E490 K492	H243 E267 W291 N310 C311 C402 C430 C455 E490 K492
BS05	HOA	A	N52 S100	N52 S100

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Nov 27 13:35:18 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8cns', asym_id = 'A', title = 'Structural and biochemical elucidation of class ...ly extracted from a marine methanogenic archaeon.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8cns', asym_id='A', title='Structural and biochemical elucidation of class ...ly extracted from a marine methanogenic archaeon.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003824,0005737,0016491,0016661,0051536', uniprot = '', pdbid = '8cns', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003824,0005737,0016491,0016661,0051536', uniprot='', pdbid='8cns', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>