Structure of PDB 8chx Chain A |
>8chxA (length=185) Species: 666 (Vibrio cholerae) [Search protein sequence] |
GAMAPKDTLSERLAMSEGFSATFNQQVLSPEGKVILTGNGKVDIARPSLF RWETETPDENLLVSDGTTLWHFDPFVEQVTLYRAEEALEQTPFVLLTRNK ASDWDAYHVEEKGDVFTLTPTALDSNQGRFQITISEKGVVQGFKVIEQDG QQSEFTFSKVKQQKPNASVFNYKVPKGVEVDDQRN |
|
PDB | 8chx A comparative analysis of lipoprotein transport proteins: LolA and LolB from Vibrio cholerae and LolA from Porphyromonas gingivalis. |
Chain | A |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
D71 D86 |
D58 D73 |
|
BS02 |
ZN |
A |
E66 E68 |
E53 E55 |
|
|
|
|