Structure of PDB 8cd8 Chain A

Receptor sequence

>8cd8A (length=262) Species: 188937 (Methanosarcina acetivorans C2A)

RMEIVKIPVVVHVVWNEEEENISDAQIQSQIDILNKDFRKLNSDVSQVPS
VWSNLIADLGIEFFLATKDPNGNQTTGITRTQTSVTFFTTSDEVKFASSG
GEDAWPADRYLNIWVCHVLKSEIGQDILGYAQFPGGPAETDGVVIVDAAF
GTTGTALPPFDKGRTATHEIGHWLNLYHIWGDELRFEDPCSRSDEVDDTP
NQADPNFGAPSYPHVSCSNGPNGDMFMNYMDYVDDKCMVMFTQGQATRVN
ACLDGPRSSFLA

3D structure

• PDB: 8cd8 Structural insights into latency of the metallopeptidase ulilysin (lysargiNase) and its unexpected inhibition by a sulfonyl-fluoride inhibitor of serine peptidases.
• Chain: A
• Resolution: 1.65 Å

Enzymatic activity

• Enzyme Commision number: 3.4.24.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	Y190 A191 H228 E229 H232 H238 Y292	Y130 A131 H168 E169 H172 H178 Y232
BS02	CA	A	W240 E243 P249 Q262 A263	W180 E183 P189 Q202 A203
BS03	CA	A	D254 V256 T259	D194 V196 T199
BS04	ZN	A	H228 H232 H238	H168 H172 H178
BS05	AES	A	I187 L188 G189 F220 Y292 V293 D295 M298	I127 L128 G129 F160 Y232 V233 D235 M238

Gene Ontology

Molecular Function

• GO:0008237 metallopeptidase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:8cd8, PDBe:8cd8, PDBj:8cd8
• PDBsum: 8cd8
• PubMed: 36857690
• UniProt: Q8TL28|ULIL_METAC Ulilysin (Gene Name=MA_3214)