Structure of PDB 8cbu Chain A |
>8cbuA (length=51) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
NFRVYYRDSPVWKGPAKLLEKGEGAVVIQDNSDIKVVPRRKAKIIRDYGK Q |
|
PDB | 8cbu Biological and Structural Analyses of New Potent Allosteric Inhibitors of HIV-1 Integrase. |
Chain | A |
Resolution | 2.44 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
U60 |
A |
W235 K266 |
W12 K43 |
|
|
|
|