Structure of PDB 8cbs Chain A |
>8cbsA (length=53) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
QNFRVYYRDSRDPVWKGPAKLLEKGEGAVVIQDNSDIKVVPRRKAKIIRD YGK |
|
PDB | 8cbs Biological and Structural Analyses of New Potent Allosteric Inhibitors of HIV-1 Integrase. |
Chain | A |
Resolution | 1.7 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
U5L |
A |
Y226 W235 |
Y6 W15 |
|
|
|
|