Structure of PDB 8c84 Chain A

Receptor sequence
>8c84A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence]
GRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHS
NKLFQYASTDMDKVLLKYTEYNEPHESRTNADIIETLRKK
3D structure
PDB8c84 Structural basis of myocyte enhancer factor-2 recruitment of class II histone deacetylases.
ChainA
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A G2 R3 K5 K31 G1 R2 K4 K30
BS02 dna A G2 R3 K4 I6 K23 R24 K30 G1 R2 K3 I5 K22 R23 K29
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8c84, PDBe:8c84, PDBj:8c84
PDBsum8c84
PubMed38492719
UniProtQ14814|MEF2D_HUMAN Myocyte-specific enhancer factor 2D (Gene Name=MEF2D)

[Back to BioLiP]