Structure of PDB 8c7u Chain A

Receptor sequence

>8c7uA (length=261) Species: 226185 (Enterococcus faecalis V583)

AMATLLEKTRQVNELLQKNNLFDVQAELPYNKMAMILGDILESNAYIISS
SGDLLGYTEKLDVNNARIKNMFKEKKFPQGYTEAVDMLKVTEANIPIDSD
LTAFPFESRELYPFGLTTIVPLYGAGKRLGTIILARVEKSFNEDDLVLAE
YSATVVGMQILYHQSRTIEAEVRSATAVQMAINTLSYSELKAVHAIFEAL
DGEEGRLTASSIADEIGITRSVIVNALRKLESAGIIESRSLGMKGTYLKV
LNQQFIKELEK

3D structure

• PDB: 8c7u Structural insights into CodY activation and DNA recognition.
• Chain: A
• Resolution: 3.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	S185 S187 T218 S220 S239 L240 G241 M242 K243	S186 S188 T219 S221 S240 L241 G242 M243 K244
BS02	dna	A	T207 A208 S209 V223 R227 S239 G241 M242 G244 T245	T208 A209 S210 V224 R228 S240 G242 M243 G245 T246
BS03	LEU	A	R66 M70 Y80 A102 F103 P104 F105	R67 M71 Y81 A103 F104 P105 F106

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005525 GTP binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0045892 negative regulation of DNA-templated transcription

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:8c7u, PDBe:8c7u, PDBj:8c7u
• PDBsum: 8c7u
• PubMed: 37326020
• UniProt: Q834K5