Structure of PDB 8c6e Chain A |
>8c6eA (length=124) Species: 7165 (Anopheles gambiae) [Search protein sequence] |
MTMKQLTNSMDMMRQACAPKFKVEEAELHGLRKSIFPANPDKELKCYAMC IAQMAGTMTKKGEISFSKTMAQIEAMLPPEMKTMAKEALTHCKDTQTSYK DPCDKAYFSAKCAADFTPDTFMFP |
|
PDB | 8c6e Influence of pH on indole-dependent heterodimeric interactions between Anopheles gambiae odorant-binding proteins OBP1 and OBP4. |
Chain | A |
Resolution | 2.05 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE2 |
A |
R15 E26 H30 |
R14 E25 H29 |
|
|
|
|