Structure of PDB 8c59 Chain A

Receptor sequence

>8c59A (length=376) Species: 272633 (Malacoplasma penetrans HF-2)

KIKVIKVFEAFAGIGSQFKALKNIARSKNWEIQHSGMVEWFVDAIVSYVA
IHSKNFNPKIERLDRDILSISNDSKMPISEYGIKKINNTIKASYLNYAKK
HFNNLFDIKKVNKDNFPKNIDIFTYSFPCQDLSVQTRSGLLWEIERILEE
IKNSFSKEEMPKYLLMENVKNLLSHKNKKNYNTWLKQLEKFGYKSKTYLL
NSKNFDNCQNRERVFCLSIRDDYLEKTGFKFKELEKVKNPPKKIKDILVD
SSNYKYLNLNKYETTTFRETKSNIISRPLKNYTTFNSENYVYNINGIGPT
LTASGANSRIKIETQQGVRYLTPLECFKYMQFDVNDFKKVQSTNLISENK
MIYIAGNSIPVKILEAIFNTLEFVNN

3D structure

• PDB: 8c59 CpG underrepresentation and the bacterial CpG-specific DNA methyltransferase M.MpeI.
• Chain: A
• Resolution: 1.7 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.37: DNA (cytosine-5-)-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	E184 R228 R230 R285 T287 S289 F302 P316 T317 T319 A320 S321 G322 N324 G373	E167 R211 R213 R268 T270 S272 F285 P299 T300 T302 A303 S304 G305 N307 G356
BS02	dna	A	N188 S191 H192 T301 F302 N303 S304 E305 R326 N366	N171 S174 H175 T284 F285 N286 S287 E288 R309 N349
BS03	SAM	A	F17 A18 G19 I20 S22 Q23 E45 W46 F112 D113 N374 S375	F11 A12 G13 I14 S16 Q17 E39 W40 F106 D107 N357 S358

Gene Ontology

Molecular Function

• GO:0003886 DNA (cytosine-5-)-methyltransferase activity
• GO:0008168 methyltransferase activity

Biological Process

• GO:0009307 DNA restriction-modification system
• GO:0032259 methylation

External links

• PDB: RCSB:8c59, PDBe:8c59, PDBj:8c59
• PDBsum: 8c59
• PubMed: 38966999
• UniProt: Q8EVR5