Structure of PDB 8c2q Chain A |
>8c2qA (length=100) Species: 90371 (Salmonella enterica subsp. enterica serovar Typhimurium) [Search protein sequence] |
GAMGMLKHISHGDMNAASDASVQQVIKGTGIVKDIDMNSKKITISHEAIP AVGWPAMTMRFTFVNADDAINALKTGNHVDFSFIQQGNISLLKSINVTQS |
|
PDB | 8c2q The battle for silver binding: How the interplay between the SilE, SilF, and SilB proteins contributes to the silver efflux pump mechanism. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
AG |
A |
H42 M53 M55 |
H46 M57 M59 |
|
|
|