Structure of PDB 8c1k Chain A

Receptor sequence

>8c1kA (length=262) Species: 9606 (Homo sapiens)

QWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEH
QLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLS
KFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFG
WSVHAPSSRRTTLAGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGK
PPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLRE
VLEHPWITANSS

3D structure

• PDB: 8c1k Selective inhibitors of the Aurora A-TPX2 protein-protein interaction exhibit in vivo efficacy as targeted anti-mitotic agent
• Chain: A
• Resolution: 2.43 Å

Enzymatic activity

• Enzyme Commision number: 2.7.11.1: non-specific serine/threonine protein kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	T4O	A	K166 E170 R179 Y199 H201 V206	K40 E44 R53 Y73 H75 V80
BS02	ADP	A	L139 G140 G142 K143 V147 A160 K162 A213 T217 E260 L263 D274	L13 G14 G16 K17 V21 A34 K36 A87 T91 E134 L137 D148
BS03	MG	A	N261 D274	N135 D148
BS04	T5L	A	F144 K162 L164 V174 Q177 E181 G276 W277	F18 K36 L38 V48 Q51 E55 G150 W151

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation

External links

• PDB: RCSB:8c1k, PDBe:8c1k, PDBj:8c1k
• PDBsum: 8c1k
• PubMed: 39190548
• UniProt: O14965|AURKA_HUMAN Aurora kinase A (Gene Name=AURKA)