Structure of PDB 8c1f Chain A

Receptor sequence

>8c1fA (length=258) Species: 9606 (Homo sapiens)

RQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVE
HQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKL
SKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADF
GWSVHAPSSRGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFE
ANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEH
PWITANSS

3D structure

• PDB: 8c1f Selective inhibitors of the Aurora A-TPX2 protein-protein interaction exhibit in vivo efficacy as targeted anti-mitotic agent
• Chain: A
• Resolution: 1.924 Å

Enzymatic activity

• Enzyme Commision number: 2.7.11.1: non-specific serine/threonine protein kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	A	L139 G140 G142 K143 V147 A160 K162 E211 A213 T217 E260 L263 D274	L14 G15 G17 K18 V22 A35 K37 E86 A88 T92 E135 L138 D149
BS02	MG	A	N261 D274	N136 D149
BS03	T5L	A	F144 K162 L164 V174 Q177 E181 G276 W277	F19 K37 L39 V49 Q52 E56 G151 W152
BS04	T2O	A	K166 E170 E175 L178 R179 H201 V206	K41 E45 E50 L53 R54 H76 V81

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation

External links

• PDB: RCSB:8c1f, PDBe:8c1f, PDBj:8c1f
• PDBsum: 8c1f
• PubMed: 39190548
• UniProt: O14965|AURKA_HUMAN Aurora kinase A (Gene Name=AURKA)