Structure of PDB 8bw6 Chain A |
>8bw6A (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] |
GAMEPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKT WTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMS |
|
PDB | 8bw6 Immunological and Structural Characterization of Titin Main Immunogenic Region; I110 Domain Is the Target of Titin Antibodies in Myasthenia Gravis. |
Chain | A |
Resolution | 1.95 Å |
3D structure |
|
|
Enzyme Commision number |
2.7.11.1: non-specific serine/threonine protein kinase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
D60 E62 |
D60 E62 |
|
|
|