Structure of PDB 8br1 Chain A

Receptor sequence
>8br1A (length=358) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
ETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHDSYVGDEAQSKRG
ILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPK
ANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNV
PIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIK
EKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQ
PSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIADRM
QKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYD
EAGPSIVH
3D structure
PDB8br1 Functional and structural insights into the multi-step activation and catalytic mechanism of bacterial ExoY nucleotidyl cyclase toxins bound to actin-profilin.
ChainA
Resolution2.044 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.4.-
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 LAB A G15 P32 Q59 Y69 D157 R183 T186 R206 E207 R210 G12 P29 Q46 Y56 D144 R170 T173 R193 E194 R197
BS02 ATP A G13 S14 G15 K18 G156 D157 V159 G182 R210 K213 E214 G302 M305 Y306 K336 G10 S11 G12 K15 G143 D144 V146 G169 R197 K200 E201 G289 M292 Y293 K323
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003785 actin monomer binding
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0005523 tropomyosin binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0019904 protein domain specific binding
GO:0031013 troponin I binding
GO:0031432 titin binding
GO:0032036 myosin heavy chain binding
GO:0042802 identical protein binding
GO:0048306 calcium-dependent protein binding
GO:0140660 cytoskeletal motor activator activity
Biological Process
GO:0010628 positive regulation of gene expression
GO:0030041 actin filament polymerization
GO:0030240 skeletal muscle thin filament assembly
GO:0048741 skeletal muscle fiber development
GO:0051017 actin filament bundle assembly
GO:0090131 mesenchyme migration
Cellular Component
GO:0001725 stress fiber
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005865 striated muscle thin filament
GO:0005884 actin filament
GO:0030027 lamellipodium
GO:0030175 filopodium
GO:0031941 filamentous actin
GO:0032432 actin filament bundle
GO:0044297 cell body
GO:0098723 skeletal muscle myofibril

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8br1, PDBe:8br1, PDBj:8br1
PDBsum8br1
PubMed37747912
UniProtP68135|ACTS_RABIT Actin, alpha skeletal muscle (Gene Name=ACTA1)

[Back to BioLiP]