Structure of PDB 8blb Chain A |
>8blbA (length=211) Species: 9606 (Homo sapiens) [Search protein sequence] |
RPALLRLSDYLLTNYRKGVRPVRDWRKPTTVSIDVIVYAILNVDEKNQVL TTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDILINEFVDVGK SPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLH TIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYA EMKFYVVIRRR |
|
PDB | 8blb Structural determinants for activity of the antidepressant vortioxetine at human and rodent 5-HT 3 receptors. |
Chain | A |
Resolution | 3.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
|
|
Molecular Function |
GO:0004888 |
transmembrane signaling receptor activity |
GO:0005216 |
monoatomic ion channel activity |
GO:0005230 |
extracellular ligand-gated monoatomic ion channel activity |
GO:0005231 |
excitatory extracellular ligand-gated monoatomic ion channel activity |
GO:0005515 |
protein binding |
GO:0015276 |
ligand-gated monoatomic ion channel activity |
GO:0022850 |
serotonin-gated monoatomic cation channel activity |
GO:0042802 |
identical protein binding |
GO:0051378 |
serotonin binding |
GO:0099507 |
ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential |
GO:1904315 |
transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential |
|
|