Structure of PDB 8blb Chain A

Receptor sequence
>8blbA (length=211) Species: 9606 (Homo sapiens) [Search protein sequence]
RPALLRLSDYLLTNYRKGVRPVRDWRKPTTVSIDVIVYAILNVDEKNQVL
TTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDILINEFVDVGK
SPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLH
TIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYA
EMKFYVVIRRR
3D structure
PDB8blb Structural determinants for activity of the antidepressant vortioxetine at human and rodent 5-HT 3 receptors.
ChainA
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 VTX A W178 M223 Y229 W148 M193 Y199
BS02 VTX A W85 R87 Y148 W55 R57 Y118
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0005216 monoatomic ion channel activity
GO:0005230 extracellular ligand-gated monoatomic ion channel activity
GO:0005231 excitatory extracellular ligand-gated monoatomic ion channel activity
GO:0005515 protein binding
GO:0015276 ligand-gated monoatomic ion channel activity
GO:0022850 serotonin-gated monoatomic cation channel activity
GO:0042802 identical protein binding
GO:0051378 serotonin binding
GO:0099507 ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential
GO:1904315 transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
Biological Process
GO:0006811 monoatomic ion transport
GO:0007210 serotonin receptor signaling pathway
GO:0034220 monoatomic ion transmembrane transport
GO:0060078 regulation of postsynaptic membrane potential
GO:0060079 excitatory postsynaptic potential
GO:0098662 inorganic cation transmembrane transport
GO:0099505 regulation of presynaptic membrane potential
GO:0140227 serotonin-gated cation-selective signaling pathway
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0032154 cleavage furrow
GO:0043005 neuron projection
GO:0045202 synapse
GO:0045211 postsynaptic membrane
GO:1902495 transmembrane transporter complex
GO:1904602 serotonin-activated cation-selective channel complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8blb, PDBe:8blb, PDBj:8blb
PDBsum8blb
PubMed38698207
UniProtP46098|5HT3A_HUMAN 5-hydroxytryptamine receptor 3A (Gene Name=HTR3A)

[Back to BioLiP]