Structure of PDB 8bd3 Chain A

Receptor sequence

>8bd3A (length=336) Species: 2649997 (Chlorella ohadii) [Search protein sequence]

ESTSLWARFCEWVTSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPV
DIDGIREPVSGSLLYGNNIITGAIIPTSNAIGLHFYPIWEAASLDEWLYN
GGPYQLIVCHFFLGVCSYMGREWELSFRLGMRPWIAVAYSAPVAAATAVF
IIYPLGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGG
SLFSAMHGSLVTSSLIRETTENESANEGYKFGQEEETYNIVAAHGYFGRL
IFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVD
SQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

3D structure

PDB

8bd3 Structure of Chlorella ohadii Photosystem II Reveals Protective Mechanisms against Environmental Stress.

Chain

Resolution

2.73 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	OEX	A	D170 E189 H332 E333 H337 D342 A344	D162 E181 H324 E325 H329 D334 A336
BS02	FE2	A	H215 H272	H207 H264
BS03	CLA	A	A153 M183 F186 I192 L193 H198 G201 V202 V205 F206 I283 T286 I290	A145 M175 F178 I184 L185 H190 G193 V194 V197 F198 I275 T278 I282
BS04	CLA	A	V157 M172 I176 T179 F180 M183	V149 M164 I168 T171 F172 M175
BS05	CLA	A	M199 V202	M191 V194
BS06	PHO	A	L41 T45 F119 Y126 E130 A146 Y147 P150 F158 L174	L33 T37 F111 Y118 E122 A138 Y139 P142 F150 L166
BS07	CLA	A	L36 T40 T43 F93 P95 I96 W97 L114 H118 L121	L28 T32 T35 F85 P87 I88 W89 L106 H110 L113
BS08	CLA	A	F33 C124 W131	F25 C116 W123
BS09	PHO	A	F206 S209 L210 M214 F255	F198 S201 L202 M206 F247
BS10	BCT	A	Y246 H272	Y238 H264

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0016682	oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009635	response to herbicide
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009507	chloroplast
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8bd3, PDBe:8bd3, PDBj:8bd3
PDBsum	8bd3
PubMed	37566050
UniProt	W8SIR2

[Back to BioLiP]