Structure of PDB 8bbr Chain A

Receptor sequence

>8bbrA (length=324) Species: 2736 (Verrucomicrobium spinosum)

QSAKYHRLNLQNPAAAPFLESYKKAITVMLQLPPSDARNWYRNAFIHTLD
CPHGNWWFVVWHRGYTGWFERTVRELSGDPNFAFPYWDWTALPQVPDSFF
NGVLDPNNPAFIASYNEFYSQLSNPMSALWNSFSTAQLQQMRNRGFQSVN
DVWQAVRDSPMFFPRGRARTLTRQNPGFDATTRRAVSIGTIRNALAPTDF
ITFGSGKTANHSESATQGILESQPHNNVHNNIGGFMQDLLSPTDPVFFAH
HSNIDRLWDVWTRKQQRLGLPTLPTGANLPLWANEPFLFFIGPDGKPVAK
NKAGDYATIGDFDYNYEPGSGEAV

3D structure

• PDB: 8bbr The Crystal Structure of Tyrosinase from Verrucomicrobium spinosum Reveals It to Be an Atypical Bacterial Tyrosinase.
• Chain: A
• Resolution: 1.64 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CU	A	H80 H86 H95	H47 H53 H62
BS02	CU	A	H258 H262 H284	H225 H229 H251

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 30 02:44:02 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8bbr', asym_id = 'A', title = 'The Crystal Structure of Tyrosinase from Verruco...eveals It to Be an Atypical Bacterial Tyrosinase.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8bbr', asym_id='A', title='The Crystal Structure of Tyrosinase from Verruco...eveals It to Be an Atypical Bacterial Tyrosinase.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016491', uniprot = '', pdbid = '8bbr', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491', uniprot='', pdbid='8bbr', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>